PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G081400.1.p
Common NameGLYMA_05G081400, LOC100796406
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 277aa    MW: 30941.7 Da    PI: 6.3628
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G081400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.71.5e-4181071100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +Ca+Ck+lrrkC+++Cv+apyfp ++p++fa+vh++FGasnv+kll++l+  +r+da++sl+yeAea++rdPvyG+vg+i+ lqq+l+q 
  Glyma.05G081400.1.p   8 PCAGCKLLRRKCTQECVFAPYFPPDNPQRFACVHRVFGASNVSKLLSELSVAQRDDAVKSLAYEAEACLRDPVYGCVGFISLLQQHLRQI 97 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++el+ +k+e
  Glyma.05G081400.1.p  98 QTELHNAKKE 107
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.4357108IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-418105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MSSSSNSPCA GCKLLRRKCT QECVFAPYFP PDNPQRFACV HRVFGASNVS KLLSELSVAQ  60
RDDAVKSLAY EAEACLRDPV YGCVGFISLL QQHLRQIQTE LHNAKKELAR YPSPQAMQVL  120
LANPGMLQHG GIVVPHLHQP VFNALSNQMV GQNVGQQEFL ETQQMFLANR DHQHQQQQQQ  180
QHVMLRSYEQ QEFMKFNNGV FEPSVGGGFG NQAEEFLSPS LALGNFENVE SYQMQQQGEQ  240
HHPIEAQLLL SPQQESQGQH QQQQCASEDG RNVVPA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525697.10.0PREDICTED: LOB domain-containing protein 36-like
TrEMBLK7KNS10.0K7KNS1_SOYBN; Uncharacterized protein
STRINGGLYMA05G09950.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-57ASYMMETRIC LEAVES 2-like 1